PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008224697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 214aa    MW: 23209.3 Da    PI: 5.5967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008224697.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45.2e-43491481100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  XP_008224697.1  49 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQDLPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNELQAQLA 143
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_008224697.1 144 KAQAE 148
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.23848149IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4349146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MECSNETMNT NYTTTSSTPL SQSPSSSPSS PPPPLPPTPT PNPPVVISPC AACKILRRRC  60
ADKCVLAPYF PPTEPAKFTI AHRVFGASNI IKFLQDLPES QRADAVSSMV YEASARIRDP  120
VYGCAGAICH LQKQVNELQA QLAKAQAELV NMQCQQANLV ALICMEMTQS NEQGSPQQSL  180
DHNFIASSHG SNQSNLSFLD DTTTLGSLWE PLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224697.11e-158PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK081e-79LBD11_ARATH; LOB domain-containing protein 11
TrEMBLM5W0701e-121M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.26e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-70LOB domain-containing protein 11